PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_14401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB
Protein Properties Length: 415aa    MW: 44990.3 Da    PI: 6.2629
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_14401.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding635.8e-20109154147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+WT+eEdell+++v q+G + W+tI+ +++ gR +kqc++rw ++
     MLOC_14401.1 109 RGPWTEEEDELLKRLVDQHGEHKWATISDHLP-GRIGKQCRERWTNH 154
                      89******************************.***********997 PP

2Myb_DNA-binding53.74.7e-17165204445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      WT+ +d ll+da+k +G++ W++Iar+++ gR+++ +k++w+
     MLOC_14401.1 165 WTEADDILLIDAHKIHGNR-WSSIARCLP-GRSENAVKNHWN 204
                      *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.692104159IPR017930Myb domain
SMARTSM007171.2E-18108157IPR001005SANT/Myb domain
SuperFamilySSF466892.55E-30108203IPR009057Homeodomain-like
PfamPF002492.8E-18109154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-23109157IPR009057Homeodomain-like
CDDcd001676.15E-17111155No hitNo description
Gene3DG3DSA:1.10.10.601.2E-17158208IPR009057Homeodomain-like
PROSITE profilePS5129416.6160211IPR017930Myb domain
SMARTSM007179.3E-15161209IPR001005SANT/Myb domain
PfamPF002493.9E-14165204IPR001005SANT/Myb domain
CDDcd001671.11E-13165207No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MASMGELLLN QELAAVAAMS TDAYGRFERY TLSPAHGFPH FQQAGSAPTV FPDTGLLVSG  60
FGMPPSTFIV MPEGTHAADA YGAEAVPVEI PVVRRQRPAA RNAGPTPFRG PWTEEEDELL  120
KRLVDQHGEH KWATISDHLP GRIGKQCRER WTNHVRPGIK KEHIWTEADD ILLIDAHKIH  180
GNRWSSIARC LPGRSENAVK NHWNATKRSL KSKRRFKKKT SQQAAPGQFT LLEEYIRDKM  240
MADENAAPPC PSSGGVGYDG QVVPGAAAML AVSGPPGMGQ YLHPADAAGS SSQAGVMNLS  300
APLPDLNAYG GEMLEGYYYP ATFPTYSDNN LLHHGPETAF PQMFSAQGSM HMHAACTNLN  360
LFPLPQHLGG GYYGSETGRS SAGGSSDQDE DVVQMASREF QTSEDEATLD LTGFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-391052123110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAPTransfer from AT3G27785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0UUP10.0M0UUP1_HORVD; Uncharacterized protein
STRINGMLOC_14401.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.13e-39myb domain protein 118